Nuclear Factor 1 (NFIA) (NM_001134673) Human Recombinant Protein

SKU
TP325878
Recombinant protein of human nuclear factor I/A (NFIA), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225878 representing NM_001134673
Red=Cloning site Green=Tags(s)

MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQK
WASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGI
PLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGH
LGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRLKS
VEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHH
RPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPN
GSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPVPDTKPPTTSTEGGAASPTSPTYSTPSTSPANRFVSVG
PRDPSFVNIPQQTQSWYLG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001128145
Locus ID 4774
UniProt ID Q12857
Cytogenetics 1p31.3
RefSeq ORF 1527
Synonyms BRMUTD; CTF; NF-I/A; NF1-A; NFI-A; NFI-L
Summary This gene encodes a member of the NF1 (nuclear factor 1) family of transcription factors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:Nuclear Factor 1 (NFIA) (NM_001134673) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304650 NFIA MS Standard C13 and N15-labeled recombinant protein (NP_005586) 10 ug
$3,255.00
PH325878 NFIA MS Standard C13 and N15-labeled recombinant protein (NP_001128145) 10 ug
$3,255.00
LC417202 NFIA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427477 NFIA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428916 NFIA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417202 Transient overexpression lysate of nuclear factor I/A (NFIA), transcript variant 2 100 ug
$436.00
LY427477 Transient overexpression lysate of nuclear factor I/A (NFIA), transcript variant 1 100 ug
$436.00
LY428916 Transient overexpression lysate of nuclear factor I/A (NFIA), transcript variant 3 100 ug
$436.00
TP304650 Recombinant protein of human nuclear factor I/A (NFIA), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.