Chk1 (CHEK1) (NM_001114122) Human Recombinant Protein

SKU
TP325807
Purified recombinant protein of Homo sapiens CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225807 protein sequence
Red=Cloning site Green=Tags(s)

MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKF
YGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDE
RDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQ
PSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTS
GGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP
DHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001107594
Locus ID 1111
UniProt ID O14757
Cytogenetics 11q24.2
RefSeq Size 4174
RefSeq ORF 1428
Synonyms CHK1
Summary The protein encoded by this gene belongs to the Ser/Thr protein kinase family. It is required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. This protein acts to integrate signals from ATM and ATR, two cell cycle proteins involved in DNA damage responses, that also associate with chromatin in meiotic prophase I. Phosphorylation of CDC25A protein phosphatase by this protein is required for cells to delay cell cycle progression in response to double-strand DNA breaks. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011]
Protein Families Druggable Genome, Protein Kinase, Stem cell - Pluripotency
Protein Pathways Cell cycle, p53 signaling pathway
Write Your Own Review
You're reviewing:Chk1 (CHEK1) (NM_001114122) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH325807 CHEK1 MS Standard C13 and N15-labeled recombinant protein (NP_001107594) 10 ug
$3,255.00
LC400510 CHEK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426457 CHEK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426458 CHEK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400510 Transient overexpression lysate of CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 1 100 ug
$436.00
LY426457 Transient overexpression lysate of CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 2 100 ug
$436.00
LY426458 Transient overexpression lysate of CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 3 100 ug
$436.00
TP762547 Purified recombinant protein of Human CHK1 checkpoint homolog (S.pombe) (CHEK1), transcript variant 1, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.