Neuro D4 (DPF1) (NM_001135155) Human Recombinant Protein

  • Product Brand Image
SKU
TP325651
Recombinant protein of human D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 1, 20 µg
In Control Promo
  $867.00
4 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225651 representing NM_001135155
Red=Cloning site Green=Tags(s)

MGGLSARPTAGRTDPAGTCWGQDPGSKMATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDS
QTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPE
GPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQ
DTASLEDRDKPYVCDICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNNHKQFYKELAWVPE
AQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCI
ECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKEKASAYITLT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001128627
Locus ID 8193
UniProt ID Q92782
Cytogenetics 19q13.2
RefSeq ORF 1242
Synonyms BAF45b; NEUD4; neuro-d4
Summary May have an important role in developing neurons by participating in regulation of cell survival, possibly as a neurospecific transcription factor. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "Neuro D4" proteins (5)
SKU Description Size Price
PH325651 DPF1 MS Standard C13 and N15-labeled recombinant protein (NP_001128627) 10 ug
$3,360.00
LC427564 DPF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432205 DPF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY427564 Transient overexpression lysate of D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 1 100 ug
$436.00
LY432205 Transient overexpression lysate of D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 2 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.