C19orf69 (ERICH4) (NM_001130514) Human Recombinant Protein

SKU TP325091

Recombinant protein of human chromosome 19 open reading frame 69 (C19orf69), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC225091 representing NM_001130514; Red=Cloning site Green=Tags(s); ; MELWRQLNQAGLVPPGLGPPPQALREVSPVEIPGQTLRTAGADTGGACDSLLWIREELGNLRRVDVQLLG; QLCSLGLEMGALREELVTILEEEEESSKEEEEDQEPQRKQEEEHLEACPAPHPPDFEMMI; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001123986
• Locus ID: 100170765
• UniProt ID: A6NGS2
• Cytogenetics: 19q13.2
• RefSeq ORF: 390
• Synonyms: C19orf69