C19orf69 (ERICH4) (NM_001130514) Human Recombinant Protein

SKU
TP325091
Recombinant protein of human chromosome 19 open reading frame 69 (C19orf69), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225091 representing NM_001130514
Red=Cloning site Green=Tags(s)

MELWRQLNQAGLVPPGLGPPPQALREVSPVEIPGQTLRTAGADTGGACDSLLWIREELGNLRRVDVQLLG
QLCSLGLEMGALREELVTILEEEEESSKEEEEDQEPQRKQEEEHLEACPAPHPPDFEMMI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001123986
Locus ID 100170765
UniProt ID A6NGS2
Cytogenetics 19q13.2
RefSeq ORF 390
Synonyms C19orf69
Write Your Own Review
You're reviewing:C19orf69 (ERICH4) (NM_001130514) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH325091 C19orf69 MS Standard C13 and N15-labeled recombinant protein (NP_001123986) 10 ug
$3,255.00
LC427223 ERICH4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY427223 Transient overexpression lysate of chromosome 19 open reading frame 69 (C19orf69) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.