NARF (NM_001038618) Human Recombinant Protein

SKU
TP324921
Recombinant protein of human nuclear prelamin A recognition factor (NARF), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224921 representing NM_001038618
Red=Cloning site Green=Tags(s)

MTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRRLCGFLKSLG
VHYVFDTTIAADFSILESQKEFVRRYRQHSEEERTLPMLTSACPGWVRYAERVLGRPITAHLCTAKSPQQ
VMGSLVKDYFARQQNLSPEKIFHVIVAPCYDKKLEALQESLPPALHGSRGADCVLTSGEIAQIMEQGDLS
VRDAAVDTLFGDLKEDKVTRHDGASSDGHLAHIFRHAAKELFNEDVEEVTYRALRNKDFQEVTLEKNGEV
VLRFAAAYGFRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLRQMEGIYADIPV
RRPESSAHVQELYQEWLEGINSPKAREVLHTTYQSQERGTHSLDIKW

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 44.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001033707
Locus ID 26502
UniProt ID Q9UHQ1
Cytogenetics 17q25.3
RefSeq Size 1786
RefSeq ORF 1191
Synonyms IOP2
Summary Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. The protein encoded by this gene binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. The encoded protein is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene, including one with a novel exon that is generated by RNA editing. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NARF (NM_001038618) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH322223 NARF MS Standard C13 and N15-labeled recombinant protein (NP_036468) 10 ug
$3,255.00
PH324921 NARF MS Standard C13 and N15-labeled recombinant protein (NP_001033707) 10 ug
$3,255.00
LC415832 NARF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422003 NARF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415832 Transient overexpression lysate of nuclear prelamin A recognition factor (NARF), transcript variant 1 100 ug
$665.00
LY422003 Transient overexpression lysate of nuclear prelamin A recognition factor (NARF), transcript variant 3 100 ug
$436.00
TP322223 Recombinant protein of human nuclear prelamin A recognition factor (NARF), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.