RANKL (TNFSF11) (NM_033012) Human Recombinant Protein

SKU
TP324778
Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224778 representing NM_033012
Red=Cloning site Green=Tags(s)

MDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAE
KAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGF
YYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKL
RSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_143026
Locus ID 8600
UniProt ID O14788
Cytogenetics 13q14.11
RefSeq Size 1931
RefSeq ORF 732
Synonyms CD254; hRANKL2; ODF; OPGL; OPTB2; RANKL; sOdf; TNLG6B; TRANCE
Summary This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
Write Your Own Review
You're reviewing:RANKL (TNFSF11) (NM_033012) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH318782 TNFSF11 MS Standard C13 and N15-labeled recombinant protein (NP_003692) 10 ug
$3,255.00
PH324778 TNFSF11 MS Standard C13 and N15-labeled recombinant protein (NP_143026) 10 ug
$3,255.00
LC401221 TNFSF11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403220 TNFSF11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401221 Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1 100 ug
$436.00
LY403220 Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 2 100 ug
$436.00
TP318782 Purified recombinant protein of Homo sapiens tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP723867 Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11 / RANKL), transcript variant 1 10 ug
$465.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.