Neurogenin3 (NEUROG3) (NM_020999) Human Recombinant Protein

SKU TP324767

Recombinant protein of human neurogenin 3 (NEUROG3), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224767 representing NM_020999; Red=Cloning site Green=Tags(s); ; MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGRSR; PKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTLR; IADHSLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAGSLSPAASLEERPGLLGATSSACLSPGSLAF; SDFL; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_066279
• Locus ID: 50674
• UniProt ID: Q9Y4Z2
• Cytogenetics: 10q22.1
• RefSeq Size: 1167
• RefSeq ORF: 642
• Synonyms: Atoh5; bHLHa7; Math4B; NGN-3; ngn3
• Summary: The protein encoded by this gene is a basic helix-loop-helix (bHLH) transcription factor involved in neurogenesis. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of congenital malabsorptive diarrhea 4 (DIAR4).[provided by RefSeq, May 2010]
• Protein Families: ES Cell Differentiation/IPS
• Protein Pathways: Maturity onset diabetes of the young