TMPRSS4 (NM_001083947) Human Recombinant Protein
CAT#: TP324725
Purified recombinant protein of Homo sapiens transmembrane protease, serine 4 (TMPRSS4), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224725 representing NM_001083947
Red=Cloning site Green=Tags(s) MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHF IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETAC RQMGYSRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGGEEASVDS WPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMY PKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTR CNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAY LNWIYNVWKAEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001077416 |
Locus ID | 56649 |
UniProt ID | Q9NRS4 |
Cytogenetics | 11q23.3 |
Refseq Size | 3534 |
Refseq ORF | 1296 |
Synonyms | CAP2; CAPH2; MT-SP2; TMPRSS3 |
Summary | This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405242 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC412678 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432994 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405242 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 |
USD 436.00 |
|
LY412678 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 1 |
USD 436.00 |
|
LY432994 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 5 |
USD 436.00 |
|
PH302384 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_899070) |
USD 3,255.00 |
|
PH303972 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_063947) |
USD 3,255.00 |
|
PH324725 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_001077416) |
USD 3,255.00 |
|
TP302384 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 2, 20 µg |
USD 867.00 |
|
TP303972 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review