TMPRSS4 (NM_001083947) Human Recombinant Protein

SKU
TP324725
Purified recombinant protein of Homo sapiens transmembrane protease, serine 4 (TMPRSS4), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224725 representing NM_001083947
Red=Cloning site Green=Tags(s)

MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHF
IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETAC
RQMGYSRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGGEEASVDS
WPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMY
PKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTR
CNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAY
LNWIYNVWKAEL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001077416
Locus ID 56649
UniProt ID Q9NRS4
Cytogenetics 11q23.3
RefSeq Size 3534
RefSeq ORF 1296
Synonyms CAP2; CAPH2; MT-SP2; TMPRSS3
Summary This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protease, Transmembrane
Write Your Own Review
You're reviewing:TMPRSS4 (NM_001083947) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302384 TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_899070) 10 ug
$3,255.00
PH303972 TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_063947) 10 ug
$3,255.00
PH324725 TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_001077416) 10 ug
$3,255.00
LC405242 TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412678 TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432994 TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405242 Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 100 ug
$436.00
LY412678 Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 1 100 ug
$436.00
LY432994 Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 5 100 ug
$436.00
TP302384 Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 2, 20 µg 20 ug
$867.00
TP303972 Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.