VRK3 (NM_016440) Human Recombinant Protein

SKU
TP324292
Recombinant protein of human vaccinia related kinase 3 (VRK3), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224292 protein sequence
Red=Cloning site Green=Tags(s)

MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVT
SPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL
KRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGR
LFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSE
RSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPH
EGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKFVDKPGPFVGPCGH
WIRPSETLQKYLKVVMALTYEEKPPYAMLRNNLEALLQDLRVSPYDPIGLPMVP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 52.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057524
Locus ID 51231
UniProt ID Q8IV63
Cytogenetics 19q13.33
RefSeq Size 2129
RefSeq ORF 1422
Summary This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. In both human and mouse, this gene has substitutions at several residues within the ATP binding motifs that in other kinases have been shown to be required for catalysis. In vitro assays indicate the protein lacks phosphorylation activity. The protein, however, likely retains its substrate binding capability. This gene is widely expressed in human tissues and its protein localizes to the nucleus. Alternative splicing results in multiple transcripts encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:VRK3 (NM_016440) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH324292 VRK3 MS Standard C13 and N15-labeled recombinant protein (NP_057524) 10 ug
$3,255.00
LC414023 VRK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422459 VRK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425502 VRK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414023 Transient overexpression lysate of vaccinia related kinase 3 (VRK3), transcript variant 1 100 ug
$665.00
LY422459 Transient overexpression lysate of vaccinia related kinase 3 (VRK3), transcript variant 2 100 ug
$665.00
LY425502 Transient overexpression lysate of vaccinia related kinase 3 (VRK3), transcript variant 2 100 ug
$436.00
TP761240 Purified recombinant protein of Human vaccinia related kinase 3 (VRK3), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.