PIG3 (TP53I3) (NM_147184) Human Recombinant Protein

SKU
TP324067
Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224067 protein sequence
Red=Cloning site Green=Tags(s)

MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVA
ELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQA
GDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGV
NLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNA
FTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_671713
Locus ID 9540
UniProt ID Q53FA7
Cytogenetics 2p23.3
RefSeq Size 1643
RefSeq ORF 996
Synonyms PIG3
Summary The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]
Protein Families Druggable Genome
Protein Pathways p53 signaling pathway
Write Your Own Review
You're reviewing:PIG3 (TP53I3) (NM_147184) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301839 TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_004872) 10 ug
$3,255.00
PH324067 TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_671713) 10 ug
$3,255.00
LC407779 TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417682 TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429226 TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407779 Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2 100 ug
$436.00
LY417682 Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1 100 ug
$436.00
LY429226 Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1 100 ug
$436.00
TP301839 Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.