PPP1R14B (NM_138689) Human Recombinant Protein

SKU TP323367

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 14B (PPP1R14B), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223367 protein sequence; Red=Cloning site Green=Tags(s); ; MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLN; LEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQK; LSTPQKK; ; SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 15.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_619634
• Locus ID: 26472
• UniProt ID: Q96C90
• Cytogenetics: 11q13.1
• RefSeq Size: 1038
• RefSeq ORF: 441
• Synonyms: PHI-1; PLCB3N; PNG; SOM172
• Summary: Inhibitor of PPP1CA. Has over 50-fold higher inhibitory activity when phosphorylated (By similarity).[UniProtKB/Swiss-Prot Function]