DNMT3B (NM_006892) Human Recombinant Protein

SKU
TP323206
Recombinant protein of human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223206 representing NM_006892
Red=Cloning site Green=Tags(s)

MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDL
TGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEF
PATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSG
DGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVAL
GLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP
NNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM
ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLC
SNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEA
PKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRN
ITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVV
AMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKK
VQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR
HLFAPLKDYFACE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 95.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 20 mM PB, pH 7.6, 10 mM NaCl
Bioactivity Surface Plasmon Ressonance (SPR) (PMID: 27468168)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_008823
Locus ID 1789
UniProt ID Q9UBC3
Cytogenetics 20q11.21
RefSeq Size 4353
RefSeq ORF 2559
Synonyms ICF; ICF1; M.HsaIIIB
Summary CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Eight alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined. [provided by RefSeq, May 2011]
Protein Families Druggable Genome, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:DNMT3B (NM_006892) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH323206 DNMT3B MS Standard C13 and N15-labeled recombinant protein (NP_008823) 10 ug
$3,255.00
LC406229 DNMT3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416333 DNMT3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406229 Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3 100 ug
$665.00
LY416333 Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.