PTP alpha (PTPRA) (NM_002836) Human Recombinant Protein
SKU
TP322592
Recombinant protein of human protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC222592 representing NM_002836
Red=Cloning site Green=Tags(s) MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNIT LGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGN SDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLAR SPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHS RVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKC AQYWPDQGCWTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGM LKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQRCQMVQTDMQ YVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMK KNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIV MLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEV GIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQ RPHMVQTLEQYEFCYKVVQEYIDAFSDYANFK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 88.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002827 |
Locus ID | 5786 |
UniProt ID | P18433 |
Cytogenetics | 20p13 |
RefSeq Size | 3643 |
RefSeq ORF | 2406 |
Synonyms | HEPTP; HLPR; HPTPA; HPTPalpha; LRP; PTPA; PTPRL2; R-PTP-alpha; RPTPA |
Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. This PTP has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation. Three alternatively spliced variants of this gene, which encode two distinct isoforms, have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304392 | PTPRA MS Standard C13 and N15-labeled recombinant protein (NP_543031) | 10 ug |
$3,255.00
|
|
PH322592 | PTPRA MS Standard C13 and N15-labeled recombinant protein (NP_002827) | 10 ug |
$3,255.00
|
|
LC401026 | PTPRA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409009 | PTPRA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409010 | PTPRA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401026 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 1 | 100 ug |
$436.00
|
|
LY409009 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 2 | 100 ug |
$436.00
|
|
LY409010 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 3 | 100 ug |
$436.00
|
|
TP304392 | Recombinant protein of human protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.