Myelin oligodendrocyte glycoprotein (MOG) (NM_206809) Human Recombinant Protein
SKU
TP322455M
Recombinant protein of human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha1, 100 µg
$2,950.00
5 Days*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC222455 representing NM_206809
Red=Cloning site Green=Tags(s) MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKIT LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.1 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_996532 |
Locus ID | 4340 |
UniProt ID | Q16653 |
Cytogenetics | 6p22.1 |
RefSeq Size | 2119 |
RefSeq ORF | 741 |
Synonyms | BTN6; BTNL11; MOGIG2; NRCLP7 |
Summary | The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.