NOL4 (NM_003787) Human Recombinant Protein

SKU
TP322286
Recombinant protein of human nucleolar protein 4 (NOL4), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222286 representing NM_003787
Red=Cloning site Green=Tags(s)

MESERDMYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQPDEV
RGGGGGAKQVLYVPVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAIS
ESYAFLPREAVTRFLMSCSECQKRMHLNPDGTDHKDNGKPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQ
QDEDESSIESDEFDMSDSTRMSAVNSDLSSNLEERMQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGG
THSREMGDSNSDGKTGLEQDEQPLNLSDSPLSAQLTSEYRIDDHNSNGKNKYKNLLISDLKMEREARENG
SKSPAHSYSSYDSGKNESVDRGAEDLSLNRGDEDEDDHEDHDDSEKVNETDGVEAERLKAFNMFVRLFVD
ENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRRMKRSGFEMSRPIPSHLTSAVAE
SILASACESESRNAAKRMRLERQQDESAPADKQCKPEATQATYSTSAVPGSQDVLYINGNGTYSYHSYRG
LGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSADEL
ENLILQQN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 71.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003778
Locus ID 8715
UniProt ID O94818
Cytogenetics 18q12.1
RefSeq Size 3899
RefSeq ORF 1914
Synonyms CT125; HRIHFB2255; NOLP
Write Your Own Review
You're reviewing:NOL4 (NM_003787) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH322286 NOL4 MS Standard C13 and N15-labeled recombinant protein (NP_003778) 10 ug
$3,255.00
LC418435 NOL4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434314 NOL4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434318 NOL4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418435 Transient overexpression lysate of nucleolar protein 4 (NOL4) 100 ug
$665.00
LY434314 Transient overexpression lysate of nucleolar protein 4 (NOL4), transcript variant 3 100 ug
$436.00
LY434318 Transient overexpression lysate of nucleolar protein 4 (NOL4), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.