Thymosin beta 4 (TMSB4X) (NM_021109) Human Recombinant Protein

SKU TP322017M

Recombinant protein of human thymosin beta 4, X-linked (TMSB4X), 100 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222017 representing NM_021109; Red=Cloning site Green=Tags(s); ; MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 4.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_066932
• Locus ID: 7114
• UniProt ID: P62328
• Cytogenetics: Xp22.2
• RefSeq Size: 657
• RefSeq ORF: 132
• Synonyms: FX; PTMB4; TB4X; TMSB4
• Summary: This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq, Jul 2008]
• Protein Pathways: Regulation of actin cytoskeleton