NEK11 (NM_024800) Human Recombinant Protein

SKU
TP321953
Recombinant protein of human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221953 representing NM_024800
Red=Cloning site Green=Tags(s)

MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNP
NETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFI
QLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYD
TKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIE
ILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKL
QAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDE
ERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCVES
DEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFN
SVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNASEAEIRECLEKVVPQASDCFEVDQLLYFEEQ
LLITMGKEPTLQNHL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 74 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079076
Locus ID 79858
UniProt ID Q8NG66
Cytogenetics 3q22.1
RefSeq Size 2939
RefSeq ORF 1935
Summary This gene encodes a member of the never in mitosis gene A family of kinases. The encoded protein localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. The encoded protein appears to play roles in DNA replication and response to genotoxic stress. Alternatively spliced transcript variants have been described.[provided by RefSeq, Mar 2009]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:NEK11 (NM_024800) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321953 NEK11 MS Standard C13 and N15-labeled recombinant protein (NP_079076) 10 ug
$3,255.00
LC407844 NEK11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411057 NEK11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431511 NEK11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407844 Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2 100 ug
$665.00
LY411057 Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1 100 ug
$665.00
LY431511 Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.