NEK11 (NM_024800) Human Recombinant Protein
SKU
TP321953
Recombinant protein of human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC221953 representing NM_024800
Red=Cloning site Green=Tags(s) MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNP NETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFI QLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYD TKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIE ILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKL QAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDE ERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCVES DEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFN SVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNASEAEIRECLEKVVPQASDCFEVDQLLYFEEQ LLITMGKEPTLQNHL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 74 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_079076 |
Locus ID | 79858 |
UniProt ID | Q8NG66 |
Cytogenetics | 3q22.1 |
RefSeq Size | 2939 |
RefSeq ORF | 1935 |
Summary | This gene encodes a member of the never in mitosis gene A family of kinases. The encoded protein localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. The encoded protein appears to play roles in DNA replication and response to genotoxic stress. Alternatively spliced transcript variants have been described.[provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome, Protein Kinase |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH321953 | NEK11 MS Standard C13 and N15-labeled recombinant protein (NP_079076) | 10 ug |
$3,255.00
|
|
LC407844 | NEK11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC411057 | NEK11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC431511 | NEK11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY407844 | Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2 | 100 ug |
$665.00
|
|
LY411057 | Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1 | 100 ug |
$665.00
|
|
LY431511 | Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.