RWDD1 (NM_001007464) Human Recombinant Protein

SKU
TP321813
Recombinant protein of human RWD domain containing 1 (RWDD1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221813 protein sequence
Red=Cloning site Green=Tags(s)

MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIF
SQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQL
FHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEV
DESLFQEMDDLELEDDEDDPDYNPADPESDSAD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001007465
Locus ID 51389
UniProt ID Q9H446
Cytogenetics 6q22.1
RefSeq Size 1562
RefSeq ORF 729
Synonyms CGI-24; PTD013
Summary Protects DRG2 from proteolytic degradation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RWDD1 (NM_001007464) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321813 RWDD1 MS Standard C13 and N15-labeled recombinant protein (NP_001007465) 10 ug
$3,255.00
LC414180 RWDD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423486 RWDD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414180 Transient overexpression lysate of RWD domain containing 1 (RWDD1), transcript variant 2 100 ug
$436.00
LY423486 Transient overexpression lysate of RWD domain containing 1 (RWDD1), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.