alpha Lactalbumin (LALBA) (NM_002289) Human Recombinant Protein

SKU
TP321214
Recombinant protein of human lactalbumin, alpha- (LALBA), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221214 representing NM_002289
Red=Cloning site Green=Tags(s)

MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYG
LFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCE
KL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002280
Locus ID 3906
UniProt ID P00709
Cytogenetics 12q13.11
RefSeq Size 742
RefSeq ORF 426
Synonyms LYZG
Summary This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Protein Pathways Galactose metabolism
Write Your Own Review
You're reviewing:alpha Lactalbumin (LALBA) (NM_002289) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321214 LALBA MS Standard C13 and N15-labeled recombinant protein (NP_002280) 10 ug
$3,255.00
LC400829 LALBA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400829 Transient overexpression lysate of lactalbumin, alpha- (LALBA) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.