ApoER2 (LRP8) (NM_017522) Human Recombinant Protein

SKU
TP320903
Recombinant protein of human low density lipoprotein receptor-related protein 8, apolipoprotein e receptor (LRP8), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220903 representing NM_017522
Red=Cloning site Green=Tags(s)

MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCIPSVWRCDEDD
DCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHK
CVPASWRCDGEKDCEGGADEAGCATSLGTCRGDEFQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNE
CLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDL
LTKNCKAAAGKSPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYM
DKASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDP
LRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFSGGNRK
TLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQPRAPDA
CELSVQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRDANEDSKMGSTVTAAVIGIIVPI
VVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPARVALSLEDDGLP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 74.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_059992
Locus ID 7804
UniProt ID Q14114
Cytogenetics 1p32.3
RefSeq Size 6994
RefSeq ORF 2100
Synonyms APOER2; HSZ75190; LRP-8; MCI1
Summary This gene encodes a member of the low density lipoprotein receptor (LDLR) family. Low density lipoprotein receptors are cell surface proteins that play roles in both signal transduction and receptor-mediated endocytosis of specific ligands for lysosomal degradation. The encoded protein plays a critical role in the migration of neurons during development by mediating Reelin signaling, and also functions as a receptor for the cholesterol transport protein apolipoprotein E. Expression of this gene may be a marker for major depressive disorder. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2011]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:ApoER2 (LRP8) (NM_017522) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH320903 LRP8 MS Standard C13 and N15-labeled recombinant protein (NP_059992) 10 ug
$3,255.00
LC413735 LRP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422708 LRP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413735 Transient overexpression lysate of low density lipoprotein receptor-related protein 8, apolipoprotein e receptor (LRP8), transcript variant 3 100 ug
$665.00
LY422708 Transient overexpression lysate of low density lipoprotein receptor-related protein 8, apolipoprotein e receptor (LRP8), transcript variant 4 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.