INPP5F (OCRL) (NM_000276) Human Recombinant Protein

SKU
TP320672
Recombinant protein of human oculocerebrorenal syndrome of Lowe (OCRL), transcript variant a, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220672 representing NM_000276
Red=Cloning site Green=Tags(s)

MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEE
TLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWYQKLDTKD
KPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLF
VPNTQSGQREGLIKHILAKREKEYVNIQTFRFFVGTWNVNGQSPDSGLEPWLNCDPNPPDIYCIGFQELD
LSTEAFFYFESVKEQEWSMAVERGLHSKAKYKKVQLVRLVGMMLLIFARKDQCRYIRDIATETVGTGIMG
KMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHEVVIWL
GDLNYRLCMPDANEVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSG
KCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMEND
FLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETV
DISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVT
KLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIID
CLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLM
AFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEED

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 104 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Enzyme activity (PMID: 29524543)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000267
Locus ID 4952
UniProt ID Q01968
Cytogenetics Xq26.1
RefSeq Size 5165
RefSeq ORF 2703
Synonyms Dent-2; DENT2; INPP5F; LOCR; NPHL2; OCRL-1; OCRL1
Summary This gene encodes an inositol polyphosphate 5-phosphatase. This protein is involved in regulating membrane trafficking and is located in numerous subcellular locations including the trans-Golgi network, clathrin-coated vesicles and, endosomes and the plasma membrane. This protein may also play a role in primary cilium formation. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Write Your Own Review
You're reviewing:INPP5F (OCRL) (NM_000276) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310491 OCRL MS Standard C13 and N15-labeled recombinant protein (NP_001578) 10 ug
$3,255.00
PH320672 OCRL MS Standard C13 and N15-labeled recombinant protein (NP_000267) 10 ug
$3,255.00
LC400105 OCRL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419853 OCRL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400105 Transient overexpression lysate of oculocerebrorenal syndrome of Lowe (OCRL), transcript variant a 100 ug
$665.00
LY419853 Transient overexpression lysate of oculocerebrorenal syndrome of Lowe (OCRL), transcript variant b 100 ug
$436.00
TP310491 Recombinant protein of human oculocerebrorenal syndrome of Lowe (OCRL), transcript variant b, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.