Integrin Linked Kinase (ILK) (NM_001014794) Human Recombinant Protein
SKU
TP320460
Recombinant protein of human integrin-linked kinase (ILK), transcript variant 2, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC220460 protein sequence
Red=Cloning site Green=Tags(s) MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTP LHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKA KAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG RWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNV LHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRM YAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001014794 |
Locus ID | 3611 |
UniProt ID | Q13418 |
Cytogenetics | 11p15.4 |
RefSeq Size | 1797 |
RefSeq ORF | 1356 |
Synonyms | HEL-S-28; ILK-1; ILK-2; P59; p59ILK |
Summary | This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of this protein is important in the epithelial to mesenchymal transition, and over-expression of this gene is implicated in tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Endometrial cancer, Focal adhesion, PPAR signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH320460 | ILK MS Standard C13 and N15-labeled recombinant protein (NP_001014794) | 10 ug |
$3,255.00
|
|
LC401438 | ILK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423078 | ILK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC423079 | ILK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY401438 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 1 | 100 ug |
$436.00
|
|
LY423078 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 2 | 100 ug |
$665.00
|
|
LY423079 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 3 | 100 ug |
$665.00
|
|
TP760620 | Purified recombinant protein of Human integrin-linked kinase (ILK), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.