FLCN (NM_144997) Human Recombinant Protein

SKU
TP320396
Recombinant protein of human folliculin (FLCN), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220396 representing NM_144997
Red=Cloning site Green=Tags(s)

MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRAHSPAEGASVE
SSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSIVRQACVRSLSCEVCPGREGP
IFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRIYLINSWPFLLGKVRGIIDELQGKALKVFEA
EQFGCPQRAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTE
DTLVQMEKLADLEEESESWDNSEAEEEEKAPVLPESTEGRELTQGPAESSSLSGCGSWQPRKLPVFKSLR
HMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGL
SPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAAL
TNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKT
YKSHLMSTVRSPTASESRN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 64.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_659434
Locus ID 201163
UniProt ID Q8NFG4
Cytogenetics 17p11.2
RefSeq Size 3717
RefSeq ORF 1737
Synonyms BHD; DENND8B; FLCL
Summary This gene is located within the Smith-Magenis syndrome region on chromosome 17. Mutations in this gene are associated with Birt-Hogg-Dube syndrome, which is characterized by fibrofolliculomas, renal tumors, lung cysts, and pneumothorax. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Renal cell carcinoma
Write Your Own Review
You're reviewing:FLCN (NM_144997) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH320396 FLCN MS Standard C13 and N15-labeled recombinant protein (NP_659434) 10 ug
$3,255.00
LC403410 FLCN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408135 FLCN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403410 Transient overexpression lysate of folliculin (FLCN), transcript variant 2 100 ug
$436.00
LY408135 Transient overexpression lysate of folliculin (FLCN), transcript variant 1 100 ug
$665.00
TP761774 Purified recombinant protein of Human folliculin (FLCN), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.