PF4V1 (NM_002620) Human Recombinant Protein

SKU TP320116L

Recombinant protein of human platelet factor 4 variant 1 (PF4V1), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220116 protein sequence; Red=Cloning site Green=Tags(s); ; MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHC; PTAQLIATLKNGRKICLDLQALLYKKIIKEHLES; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002611
• Locus ID: 5197
• UniProt ID: P10720
• Cytogenetics: 4q13.3
• RefSeq Size: 741
• RefSeq ORF: 312
• Synonyms: CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
• Summary: The protein encoded by this gene is a chemokine that is highly similar to platelet factor 4. The encoded protein displays a strong antiangiogenic function and is regulated by chemokine (C-X-C motif) receptor 3. This protein also impairs tumor growth and can protect against blood-retinal barrier breakdown in diabetes patients. [provided by RefSeq, Nov 2015]
• Protein Families: Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction