NDRG2 (NM_201539) Human Recombinant Protein

SKU
TP320003
Purified recombinant protein of Homo sapiens NDRG family member 2 (NDRG2), transcript variant 6, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220003 representing NM_201539
Red=Cloning site Green=Tags(s)

MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAILTYHD
VGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDELADMIPCVLQYLNFSTI
IGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGN
SELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDP
TRTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLS
QSSESGTLSSGPPGHTMEVSC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 40.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_963833
Locus ID 57447
UniProt ID Q9UN36
Cytogenetics 14q11.2
RefSeq Size 2052
RefSeq ORF 1113
Synonyms SYLD
Summary This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2017]
Write Your Own Review
You're reviewing:NDRG2 (NM_201539) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303712 NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963832) 10 ug
$3,255.00
PH310598 NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963835) 10 ug
$3,255.00
PH311577 NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_057334) 10 ug
$3,255.00
PH312237 NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963831) 10 ug
$3,255.00
PH314708 NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963834) 10 ug
$3,255.00
PH319812 NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963293) 10 ug
$3,255.00
PH320003 NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963833) 10 ug
$3,255.00
LC404442 NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404443 NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404444 NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404445 NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404446 NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404447 NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404448 NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414093 NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404442 Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 1 100 ug
$436.00
LY404443 Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 3 100 ug
$436.00
LY404444 Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 4 100 ug
$436.00
LY404445 Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 5 100 ug
$436.00
LY404446 Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 6 100 ug
$436.00
LY404447 Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 7 100 ug
$436.00
LY404448 Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 8 100 ug
$436.00
LY414093 Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 2 100 ug
$436.00
TP303712 Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310598 Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 8, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311577 Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312237 Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314708 Purified recombinant protein of Homo sapiens NDRG family member 2 (NDRG2), transcript variant 7, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319812 Purified recombinant protein of Homo sapiens NDRG family member 2 (NDRG2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760733 Purified recombinant protein of Human NDRG family member 2 (NDRG2), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.