Acid sphingomyelinase (SMPD1) (NM_000543) Human Recombinant Protein

SKU
TP319758
Purified recombinant protein of Homo sapiens sphingomyelin phosphodiesterase 1, acid lysosomal (SMPD1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219758 representing NM_000543
Red=Cloning site Green=Tags(s)

MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAEAHPLSPQGHP
ARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLF
EDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLH
WDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGD
IPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKA
WEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD
KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTY
IGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVY
RMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMPDGSLPEAQSLWPRPLF
C

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 65 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000534
Locus ID 6609
UniProt ID P17405
Cytogenetics 11p15.4
RefSeq Size 2473
RefSeq ORF 1893
Synonyms ASM; ASMASE; NPD
Summary The protein encoded by this gene is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB). Multiple transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Lysosome, Metabolic pathways, Sphingolipid metabolism
Write Your Own Review
You're reviewing:Acid sphingomyelinase (SMPD1) (NM_000543) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH319758 SMPD1 MS Standard C13 and N15-labeled recombinant protein (NP_000534) 10 ug
$3,255.00
LC400191 SMPD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423515 SMPD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400191 Transient overexpression lysate of sphingomyelin phosphodiesterase 1, acid lysosomal (SMPD1), transcript variant ASM-1 100 ug
$665.00
LY423515 Transient overexpression lysate of sphingomyelin phosphodiesterase 1, acid lysosomal (SMPD1), transcript variant ASM-2 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.