GPR73A (PROKR1) (NM_138964) Human Recombinant Protein

SKU
TP319745
Recombinant protein of human prokineticin receptor 1 (PROKR1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219745 representing NM_138964
Red=Cloning site Green=Tags(s)

METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFAAKIVIGMALV
GIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWEHGHVLCTSV
NYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTATGLIALVWTVSILIAIPSAYFTTETVLVIVK
SQEKIFCGQIWPVDQQLYYKSYFLFIFGIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRR
KTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTV
KYFKKIMLLHWKASYNGGKSSADLDLKTIGMPATEEVDCIRLK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 44.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_620414
Locus ID 10887
UniProt ID Q8TCW9
Cytogenetics 2p13.3
RefSeq Size 1182
RefSeq ORF 1179
Synonyms GPR73; GPR73a; PK-R1; PKR1; ZAQ
Summary This gene encodes a member of the G-protein-coupled receptor family. The encoded protein binds to prokineticins (1 and 2), leading to the activation of MAPK and STAT signaling pathways. Prokineticins are protein ligands involved in angiogenesis and inflammation. The encoded protein is expressed in peripheral tissues such as those comprising the circulatory system, lungs, reproductive system, endocrine system and the gastrointestinal system. The protein may be involved in signaling in human fetal ovary during initiation of primordial follicle formation. Sequence variants in this gene may be associated with recurrent miscarriage. [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome, GPCR, Transmembrane
Write Your Own Review
You're reviewing:GPR73A (PROKR1) (NM_138964) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH319745 PROKR1 MS Standard C13 and N15-labeled recombinant protein (NP_620414) 10 ug
$3,255.00
LC403372 PROKR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403372 Transient overexpression lysate of prokineticin receptor 1 (PROKR1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.