CD272 (BTLA) (NM_181780) Human Recombinant Protein
CAT#: TP319458
Recombinant protein of human B and T lymphocyte associated (BTLA), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219458 representing NM_181780
Red=Cloning site Green=Tags(s) MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVT WCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS ERPSKDEMASRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEA STRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPT EYASICVRS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_861445 |
Locus ID | 151888 |
UniProt ID | Q7Z6A9 |
Cytogenetics | 3q13.2 |
Refseq Size | 1239 |
Refseq ORF | 867 |
Synonyms | BTLA1; CD272 |
Summary | This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. [provided by RefSeq, Aug 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403628 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421272 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425974 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403628 | Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 1 |
USD 436.00 |
|
LY421272 | Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 2 |
USD 436.00 |
|
PH319458 | BTLA MS Standard C13 and N15-labeled recombinant protein (NP_861445) |
USD 3,255.00 |
|
TP700213 | Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells |
USD 867.00 |
|
TP700215 | Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells |
USD 867.00 |
|
TP720688 | Purified recombinant protein of Human B and T lymphocyte associated (BTLA), transcript variant 1 |
USD 330.00 |
|
TP723966 | Human BTLA Protein, mFc-His Tag |
USD 520.00 |
{0} Product Review(s)
Be the first one to submit a review