CD272 (BTLA) (NM_181780) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC219458] |
Predicted MW | 32.6 kDa |
Protein Sequence |
Protein Sequence
>RC219458 representing NM_181780
Red=Cloning site Green=Tags(s) MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVT WCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS ERPSKDEMASRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEA STRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPT EYASICVRS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_861445 |
RefSeq Size | 1239 |
RefSeq ORF | 867 |
Synonyms | BTLA1; CD272 |
Locus ID | 151888 |
UniProt ID | Q7Z6A9 |
Cytogenetics | 3q13.2 |
Summary | This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. [provided by RefSeq, Aug 2011] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC403628 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421272 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425974 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403628 | Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 1 | 100 ug |
$436.00
|
|
LY421272 | Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 2 | 100 ug |
$436.00
|
|
TP319458 | Recombinant protein of human B and T lymphocyte associated (BTLA), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP700213 | Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells | 20 ug |
$867.00
|
|
TP700215 | Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells | 20 ug |
$867.00
|
|
TP720688 | Purified recombinant protein of Human B and T lymphocyte associated (BTLA), transcript variant 1 | 10 ug |
$215.00
|
|
TP723966 | Human BTLA Protein, mFc-His Tag | 100 ug |
$595.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.