CD272 (BTLA) (NM_181780) Human Mass Spec Standard

SKU
PH319458
BTLA MS Standard C13 and N15-labeled recombinant protein (NP_861445)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219458]
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC219458 representing NM_181780
Red=Cloning site Green=Tags(s)

MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVT
WCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS
ERPSKDEMASRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEA
STRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPT
EYASICVRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_861445
RefSeq Size 1239
RefSeq ORF 867
Synonyms BTLA1; CD272
Locus ID 151888
UniProt ID Q7Z6A9
Cytogenetics 3q13.2
Summary This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. [provided by RefSeq, Aug 2011]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CD272 (BTLA) (NM_181780) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403628 BTLA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421272 BTLA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425974 BTLA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403628 Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 1 100 ug
$436.00
LY421272 Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 2 100 ug
$436.00
TP319458 Recombinant protein of human B and T lymphocyte associated (BTLA), transcript variant 1, 20 µg 20 ug
$737.00
TP700213 Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells 20 ug
$867.00
TP700215 Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells 20 ug
$867.00
TP720688 Purified recombinant protein of Human B and T lymphocyte associated (BTLA), transcript variant 1 10 ug
$215.00
TP723966 Human BTLA Protein, mFc-His Tag 100 ug
$595.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.