OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD272 (BTLA) (NM_181780) Human Mass Spec Standard

Be the first to review this product
SKU
PH319458
BTLA MS Standard C13 and N15-labeled recombinant protein (NP_861445)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505688 BTLA mouse monoclonal antibody,clone OTI2E4 100 ul
$447.00
LY403628 Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CD272 or NM_181780"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219458
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC219458 representing NM_181780
Red=Cloning site Green=Tags(s)

MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVT
WCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS
ERPSKDEMASRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEA
STRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPT
EYASICVRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_861445
RefSeq Size 1239
RefSeq ORF 867
Synonyms BTLA1; CD272
Locus ID 151888
UniProt ID Q7Z6A9
Cytogenetics 3q13.2
Summary This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. provided by RefSeq, Aug 2011
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD272" proteins (9)
SKU Description Size Price
LC403628 Lyophilized BTLA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421272 Lyophilized BTLA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403628 Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421272 Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP319458 Recombinant protein of human B and T lymphocyte associated (BTLA), transcript variant 1, 20 µg 20 ug
$737.00
TP700213 Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells 20 ug
$900.00
TP700215 Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells 20 ug
$900.00
TP720688 Purified recombinant protein of Human B and T lymphocyte associated (BTLA), transcript variant 1 10 ug
$220.00
TP723966 Recombinant human BTLA protein with C-terminal mouse Fc and 6×His tag 100 ug
$905.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products