Glutaredoxin 1 (GLRX) (NM_002064) Human Recombinant Protein

SKU TP319385L

Recombinant protein of human glutaredoxin (thioltransferase) (GLRX), transcript variant 1, 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219385 representing NM_002064; Red=Cloning site Green=Tags(s); ; MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV; PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002055
• Locus ID: 2745
• UniProt ID: P35754
• Cytogenetics: 5q15
• RefSeq Size: 1328
• RefSeq ORF: 318
• Synonyms: GRX; GRX1
• Summary: This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2011]
• Protein Families: Druggable Genome