CD39 (ENTPD1) (NM_001776) Human Recombinant Protein
CAT#: TP319359
Purified recombinant protein of Homo sapiens ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219359 protein sequence
Red=Cloning site Green=Tags(s) MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAE KENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRME SEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFG ALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRD PCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFL PPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYIL SLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFLMVLFSLVLFT VAIIGLLIFHKPSYFWKDMV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001767 |
Locus ID | 953 |
UniProt ID | P49961 |
Cytogenetics | 10q24.1 |
Refseq Size | 12493 |
Refseq ORF | 1533 |
Synonyms | ATPDase; CD39; NTPDase-1; SPG64 |
Summary | The protein encoded by this gene is a plasma membrane protein that hydrolyzes extracellular ATP and ADP to AMP. Inhibition of this protein's activity may confer anticancer benefits. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015] |
Protein Families | Transmembrane |
Protein Pathways | Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC431349 | ENTPD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431418 | ENTPD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY431349 | Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 5 |
USD 436.00 |
|
LY431418 | Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 4 |
USD 436.00 |
|
PH319359 | ENTPD1 MS Standard C13 and N15-labeled recombinant protein (NP_001767) |
USD 3,255.00 |
|
TP762301 | Purified recombinant protein of Human ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 1, Thr38-Met307, with N-terminal His tag, expressed in E.coli, 50ug |
USD 249.00 |
{0} Product Review(s)
Be the first one to submit a review