CD39 (ENTPD1) (NM_001776) Human Mass Spec Standard

SKU
PH319359
ENTPD1 MS Standard C13 and N15-labeled recombinant protein (NP_001767)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219359]
Predicted MW 58 kDa
Protein Sequence
Protein Sequence
>RC219359 protein sequence
Red=Cloning site Green=Tags(s)

MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAE
KENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRME
SEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFG
ALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRD
PCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFL
PPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYIL
SLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFLMVLFSLVLFT
VAIIGLLIFHKPSYFWKDMV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001767
RefSeq Size 12493
RefSeq ORF 1530
Synonyms ATPDase; CD39; NTPDase-1; SPG64
Locus ID 953
UniProt ID P49961
Cytogenetics 10q24.1
Summary The protein encoded by this gene is a plasma membrane protein that hydrolyzes extracellular ATP and ADP to AMP. Inhibition of this protein's activity may confer anticancer benefits. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]
Protein Families Transmembrane
Protein Pathways Purine metabolism, Pyrimidine metabolism
Write Your Own Review
You're reviewing:CD39 (ENTPD1) (NM_001776) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC431349 ENTPD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431418 ENTPD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY431349 Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 5 100 ug
$436.00
LY431418 Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 4 100 ug
$436.00
TP319359 Purified recombinant protein of Homo sapiens ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 1, 20 µg 20 ug
$737.00
TP762301 Purified recombinant protein of Human ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 1, Thr38-Met307, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.