LAMP1 (NM_005561) Human Recombinant Protein
CAT#: TP319208
Recombinant protein of human lysosomal-associated membrane protein 1 (LAMP1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219208 representing NM_005561
Red=Cloning site Green=Tags(s) MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSD ATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVE SITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSP SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHS EGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAF SVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005552 |
Locus ID | 3916 |
UniProt ID | P11279, A0A024RDY3 |
Cytogenetics | 13q34 |
Refseq Size | 2560 |
Refseq ORF | 1251 |
Synonyms | CD107a; LAMPA; LGP120 |
Summary | The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008] |
Protein Families | ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Lysosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417223 | LAMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417223 | Transient overexpression lysate of lysosomal-associated membrane protein 1 (LAMP1) |
USD 436.00 |
|
PH319208 | LAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_005552) |
USD 3,255.00 |
|
TP720401 | Purified recombinant protein of Homo sapiens lysosomal-associated membrane protein 1 (LAMP1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review