LAMP1 (NM_005561) Human Recombinant Protein

CAT#: TP319208

Recombinant protein of human lysosomal-associated membrane protein 1 (LAMP1), 20 µg

Product Images

Coomassie blue staining of purified LAMP1 protein (Cat# TP319208). The protein was produced from HEK293T cells transfected with LAMP1 cDNA clone (Cat# RC219208) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219208 representing NM_005561
  Red=Cloning site Green=Tags(s)
  
  MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSD
  ATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVE
  SITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSP
  SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHS
  EGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAF
  SVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005552
• Locus ID: 3916
• UniProt ID: P11279, A0A024RDY3
• Cytogenetics: 13q34
• Refseq Size: 2560
• Refseq ORF: 1251
• Synonyms: CD107a; LAMPA; LGP120
• Summary: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008]
• Protein Families: ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: Lysosome