LAMP1 (NM_005561) Human Mass Spec Standard

SKU
PH319208
LAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_005552)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219208]
Predicted MW 44.88 kDa
Protein Sequence
Protein Sequence
>RC219208 representing NM_005561
Red=Cloning site Green=Tags(s)

MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSD
ATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVE
SITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSP
SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHS
EGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAF
SVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005552
RefSeq Size 2560
RefSeq ORF 1251
Synonyms CD107a; LAMPA; LGP120
Locus ID 3916
UniProt ID P11279
Cytogenetics 13q34
Summary The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008]
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Lysosome
Write Your Own Review
You're reviewing:LAMP1 (NM_005561) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417223 LAMP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417223 Transient overexpression lysate of lysosomal-associated membrane protein 1 (LAMP1) 100 ug
$436.00
TP319208 Recombinant protein of human lysosomal-associated membrane protein 1 (LAMP1), 20 µg 20 ug
$867.00
TP720401 Purified recombinant protein of Homo sapiens lysosomal-associated membrane protein 1 (LAMP1) 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.