Nucleolin (NCL) (NM_005381) Human Recombinant Protein

SKU
TP319082
Recombinant protein of human nucleolin (NCL), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219082 representing NM_005381
Red=Cloning site Green=Tags(s)

MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTK
KVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNA
KKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEA
METTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKR
KKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFG
YVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR
LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVL
SNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGP
RGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAM
EDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDH
KPQGKKTKFE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 76.4 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity EMSA reaction positive control (PMID: 26354862)
Taq polymerase assay (regulator) (PMID: 26354862)
Binding assay (Dimethylsulfate footprinting) (PMID: 26354862)
Binding assay (FRET) (PMID: 26354862)
Surface Plasmon Ressonance (SPR) (PMID: 26354862)
Association in cell culture (PMID: 26707270)
Surface Plasmon Ressonance (SPR) (PMID: 27032748)
EMSA reaction positive control (PMID: 27913192)
ELISA binding assay (PMID: 28974366)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005372
Locus ID 4691
UniProt ID P19338
Cytogenetics 2q37.1
RefSeq Size 2732
RefSeq ORF 2130
Synonyms C23; Nsr1
Summary Nucleolin (NCL), a eukaryotic nucleolar phosphoprotein, is involved in the synthesis and maturation of ribosomes. It is located mainly in dense fibrillar regions of the nucleolus. Human NCL gene consists of 14 exons with 13 introns and spans approximately 11kb. The intron 11 of the NCL gene encodes a small nucleolar RNA, termed U20. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Pathogenic Escherichia coli infection
Write Your Own Review
You're reviewing:Nucleolin (NCL) (NM_005381) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH319082 NCL MS Standard C13 and N15-labeled recombinant protein (NP_005372) 10 ug
$3,255.00
LC417337 NCL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417337 Transient overexpression lysate of nucleolin (NCL) 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.