DNMT3L (NM_175867) Human Recombinant Protein
SKU
TP319008
Recombinant protein of human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 2, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC219008 protein sequence
Red=Cloning site Green=Tags(s) MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQVHTQHPLFEG GICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNW VCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLE SGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPGPF FWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_787063 |
Locus ID | 29947 |
UniProt ID | Q9UJW3 |
Cytogenetics | 21q22.3 |
RefSeq Size | 1720 |
RefSeq ORF | 1158 |
Summary | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a nuclear protein with similarity to DNA methyltransferases, but is not thought to function as a DNA methyltransferase as it does not contain the amino acid residues necessary for methyltransferase activity. However, it does stimulate de novo methylation by DNA cytosine methyltransferase 3 alpha and is thought to be required for the establishment of maternal genomic imprints. This protein also mediates transcriptional repression through interaction with histone deacetylase 1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH319008 | DNMT3L MS Standard C13 and N15-labeled recombinant protein (NP_787063) | 10 ug |
$3,255.00
|
|
LC402250 | DNMT3L HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406188 | DNMT3L HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402250 | Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1 | 100 ug |
$436.00
|
|
LY406188 | Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 2 | 100 ug |
$436.00
|
|
TP710295 | Purified recombinant protein of Human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
TP761810 | Purified recombinant protein of Human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.