OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRAF3 (NM_003300) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318682
Recombinant protein of human TNF receptor-associated factor 3 (TRAF3), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA322870 Anti-TRAF3 rabbit polyclonal antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TRAF3 or NM_003300"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218682 protein sequence
Red=Cloning site Green=Tags(s)

MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGH
RFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKND
CHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSV
QTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNE
SVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSM
KSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF
KQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV
DTSDLPDP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 64.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003291
Locus ID 7187
UniProt ID Q13114
Cytogenetics 14q32.32
RefSeq Size 7654
RefSeq ORF 1704
Synonyms CAP-1; CAP1; CD40bp; CRAF1; IIAE5; LAP1; RNF118
Summary The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. The protein also plays a role in the regulation of antiviral response. Mutations in this are associated with Encephalopathy, acute, infection-induced, herpes-specific 5. provided by RefSeq, Jul 2020
Protein Categories Cytokines, Intracellular Proteins, Nervous system Diseases
Protein Families Druggable Genome
Protein Pathways Pathways in cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRAF3" proteins (5)
SKU Description Size Price
PH318682 TRAF3 MS Standard C13 and N15-labeled recombinant protein (NP_003291) 10 ug
$3,360.00
LC403439 Lyophilized TRAF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418781 Lyophilized TRAF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403439 Transient overexpression lysate of TNF receptor-associated factor 3 (TRAF3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY418781 Transient overexpression lysate of TNF receptor-associated factor 3 (TRAF3), transcript variant 3 (as WB positive control) 100 ug
$436.00

file-alt Citations

E3 ligase Nedd4l promotes antiviral innate immunity by catalyzing K29-linked cysteine ubiquitination of TRAF3
Gao, Ma, Yuan et al
Nat Commun (2021) 12 (1), 1194 DOI: 10.1038/s41467-021-21456-1
Cited by 116
AI Summary: OriGene products, specifically recombinant Nedd4l (TP327866) and recombinant TRAF3 (TP318682), were used in this study to investigate the molecular mechanisms by which Nedd4l catalyzes K29-linked ubiquitination of TRAF3 and promotes antiviral innate immunity.
Snippet: …GST-TRAF3 (3384H) was from Creative Biomart. Recombinant Nedd4l (TP327866) and recombinant TRAF3 (TP318682) were from Origene. …Preparation of periton;Recombinant Nedd4l (TP327866) and recombinant TRAF3 (TP318682) were from Origene
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products