FGFR1OP2 (NM_015633) Human Recombinant Protein

SKU
TP318080
Recombinant protein of human FGFR1 oncogene partner 2 (FGFR1OP2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218080 representing NM_015633
Red=Cloning site Green=Tags(s)

MSCTIEKALADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHRPRSTLVMGIQ
QENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQHSKIDMVHRNK
SEGFFLDASRHILEAPQHGLERRHLEANQNELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQE
NKGLREILQITRESFLNLRKDDASESTSLSALVTNSDLSLRKS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056448
Locus ID 26127
UniProt ID Q9NVK5
Cytogenetics 12p11.23
RefSeq Size 2306
RefSeq ORF 759
Synonyms HSPC123-like; WIT3.0
Summary May be involved in wound healing pathway.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:FGFR1OP2 (NM_015633) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH318080 FGFR1OP2 MS Standard C13 and N15-labeled recombinant protein (NP_056448) 10 ug
$3,255.00
LC414429 FGFR1OP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414429 Transient overexpression lysate of FGFR1 oncogene partner 2 (FGFR1OP2), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.