PYK2 (PTK2B) (NM_173175) Human Recombinant Protein

SKU
TP317684
Recombinant protein of human PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217684 representing NM_173175
Red=Cloning site Green=Tags(s)

MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREI
ITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDF
MESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGL
DLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLV
IGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDG
YCRLQGEHQGSLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLI
GIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASP
ECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLE
NKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYR
TPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQEEDFIQPSSREEAQQLWEAEKVKMRQILDKQQ
KQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYL
NVMELVWAVLELKNELCQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAE
LINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 111 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775267
Locus ID 2185
UniProt ID Q14289
Cytogenetics 8p21.2
RefSeq Size 3936
RefSeq ORF 2901
Synonyms CADTK; CAKB; FADK2; FAK2; PKB; PTK; PYK2; RAFTK
Summary This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Calcium signaling pathway, Chemokine signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity
Write Your Own Review
You're reviewing:PYK2 (PTK2B) (NM_173175) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303808 PTK2B MS Standard C13 and N15-labeled recombinant protein (NP_004094) 10 ug
$3,255.00
PH305372 PTK2B MS Standard C13 and N15-labeled recombinant protein (NP_775266) 10 ug
$3,255.00
PH317684 PTK2B MS Standard C13 and N15-labeled recombinant protein (NP_775267) 10 ug
$3,255.00
LC401325 PTK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406631 PTK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406632 PTK2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401325 Transient overexpression lysate of PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 2 100 ug
$436.00
LY406631 Transient overexpression lysate of PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 1 100 ug
$436.00
LY406632 Transient overexpression lysate of PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 4 100 ug
$665.00
TP303808 Recombinant protein of human PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 2, 20 µg 20 ug
$867.00
TP305372 Recombinant protein of human PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.