OST beta (SLC51B) (NM_178859) Human Recombinant Protein

SKU TP317638M

Recombinant protein of human organic solute transporter beta (OSTbeta), 100 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217638 protein sequence; Red=Cloning site Green=Tags(s); ; MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPP; EKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_849190
• Locus ID: 123264
• UniProt ID: Q86UW2
• Cytogenetics: 15q22.31
• RefSeq Size: 940
• RefSeq ORF: 384
• Synonyms: OSTB; OSTBETA
• Summary: Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Modulates SLC51A glycosylation, membrane trafficking and stability activities.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane