S6K1 (RPS6KB1) (NM_003161) Human Recombinant Protein

CAT#: TP317324

Recombinant protein of human ribosomal protein S6 kinase, 70kDa, polypeptide 1 (RPS6KB1), 20 µg

Product Images

Audiograph of electrophoretic mobility shift assay using labeled RNA probes for the 11 and 13DNR DNR alleles, and purified candidate-binding proteins including S6K (OriGene TP317324). Results confirm the binding for 4E-BP, elF4E, and ELAVL4, seen as band upshift from the unlabeled oligos. Figure cited from Transl Psychiatry, PMID: 27801893

• 

  Coomassie blue staining of purified RPS6KB1 protein (Cat# TP317324). The protein was produced from HEK293T cells transfected with RPS6KB1 cDNA clone (Cat# RC217324) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217324 representing NM_003161
  Red=Cloning site Green=Tags(s)
  
  MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCE
  KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHT
  KAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLH
  QKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLG
  ALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHP
  FFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
  SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSG
  EASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 59 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: EMSA reaction (PMID: 27801893)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003152
• Locus ID: 6198
• UniProt ID: P23443
• Cytogenetics: 17q23.1
• Refseq Size: 5332
• Refseq ORF: 1575
• Synonyms: p70 S6KA; p70(S6K)-alpha; p70-alpha; p70-S6K; PS6K; S6K; S6K-beta-1; S6K1; STK14A
• Summary: This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17. [provided by RefSeq, Jan 2013]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Acute myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Insulin signaling pathway, mTOR signaling pathway, TGF-beta signaling pathway