Guanylin (GUCA2A) (NM_033553) Human Recombinant Protein

SKU TP317195

Recombinant protein of human guanylate cyclase activator 2A (guanylin) (GUCA2A), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217195 representing NM_033553; Red=Cloning site Green=Tags(s); ; MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCS; NPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_291031
• Locus ID: 2980
• UniProt ID: Q02747
• Cytogenetics: 1p34.2
• RefSeq Size: 575
• RefSeq ORF: 345
• Synonyms: GCAP-I; GUCA2; STARA
• Summary: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein, Transmembrane