FGF13 (NM_033642) Human Recombinant Protein

SKU
TP317121
Purified recombinant protein of Homo sapiens fibroblast growth factor 13 (FGF13), transcript variant 6, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217121 representing NM_033642
Red=Cloning site Green=Tags(s)

MALLRKSYSEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYL
AMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAH
FLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_378668
Locus ID 2258
UniProt ID Q92913
Cytogenetics Xq26.3-q27.1
RefSeq Size 1937
RefSeq ORF 576
Synonyms DEE90; FGF-13; FGF2; FHF-2; FHF2; LINC00889
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked cognitive disability mapping to this region. Alternative splicing of this gene at the 5' end results in several transcript variants encoding different isoforms with different N-termini. [provided by RefSeq, Nov 2008]
Protein Families Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:FGF13 (NM_033642) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317121 FGF13 MS Standard C13 and N15-labeled recombinant protein (NP_378668) 10 ug
$3,255.00
LC409478 FGF13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418207 FGF13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409478 Transient overexpression lysate of fibroblast growth factor 13 (FGF13), transcript variant 6 100 ug
$436.00
LY418207 Transient overexpression lysate of fibroblast growth factor 13 (FGF13), transcript variant 1 100 ug
$436.00
TP761821 Purified recombinant protein of Human fibroblast growth factor 13 (FGF13), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.