CCBL1 (KYAT1) (NM_004059) Human Recombinant Protein

SKU
TP316317M
Recombinant protein of human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 1, 100 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$2,508.00
5 Days*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216317 representing NM_004059
Red=Cloning site Green=Tags(s)

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP
PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV
FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC
ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC
PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK
MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV
EL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity The specific activity of KATI was determined by measuring the product Kynurenic acid formation from a conversion of Kynurenine. The reaction was carried out at 37? for 15min in the buffer containing 100 mM PBS, pH7.4, 2 mM a-oxoglutarate, 40µM PLP (pyridoxal 5'-phosphate), and 0.5 mM kynurenine as the substrate.
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004050
Locus ID 883
UniProt ID Q16773
Cytogenetics 9q34.11
RefSeq Size 1925
RefSeq ORF 1266
Synonyms CCBL1; GTK; KAT1; KATI
Summary This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CCBL1 (KYAT1) (NM_004059) Human Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.