CYP26A1 (NM_000783) Human Recombinant Protein

SKU
TP316278
Recombinant protein of human cytochrome P450, family 26, subfamily A, polypeptide 1 (CYP26A1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216278 representing NM_000783
Red=Cloning site Green=Tags(s)

MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQM
KRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVI
MRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQL
VEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWE
RGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEIL
EQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARF
THFHGEI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000774
Locus ID 1592
UniProt ID O43174
Cytogenetics 10q23.33
RefSeq Size 2099
RefSeq ORF 1491
Synonyms CP26; CYP26; P450RAI; P450RAI1
Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein acts on retinoids, including all-trans-retinoic acid (RA), with both 4-hydroxylation and 18-hydroxylation activities. This enzyme regulates the cellular level of retinoic acid which is involved in regulation of gene expression in both embryonic and adult tissues. Two alternatively spliced transcript variants of this gene, which encode the distinct isoforms, have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, P450, Transmembrane
Protein Pathways Retinol metabolism
Write Your Own Review
You're reviewing:CYP26A1 (NM_000783) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316278 CYP26A1 MS Standard C13 and N15-labeled recombinant protein (NP_000774) 10 ug
$3,255.00
LC400267 CYP26A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409260 CYP26A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400267 Transient overexpression lysate of cytochrome P450, family 26, subfamily A, polypeptide 1 (CYP26A1), transcript variant 1 100 ug
$665.00
LY409260 Transient overexpression lysate of cytochrome P450, family 26, subfamily A, polypeptide 1 (CYP26A1), transcript variant 2 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.