Matrilin 2 (MATN2) (NM_002380) Human Recombinant Protein

SKU
TP316227
Recombinant protein of human matrilin 2 (MATN2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216227 representing NM_002380
Red=Cloning site Green=Tags(s)

MEKMLAGCFLLILGQIVLLPAEARERSRGRSISRGRHARTHPQTALLESSCENKRADLVFIIDSSRSVNT
HDYAKVKEFIVDILQFLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAI
QYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAEVAAKARDTGILIFAIGVGQVDFNTLKSIGSE
PHEDHVFLVANFSQIETLTSVFQKKLCTAHMCSTLEHNCAHFCINIPGSYVCRCKQGYILNSDQTTCRIQ
DLCAMEDHNCEQLCVNVPGSFVCQCYSGYALAEDGKRCVAVDYCASENHGCEHECVNADGSYLCQCHEGF
ALNPDEKTCTKIDYCASSNHGCQHECVNTDDSYSCHCLKGFTLNPDKKTCRRINYCALNKPGCEHECVNM
EESYYCRCHRGYTLDPNGKTCSRVDHCAQQDHGCEQLCLNTEDSFVCQCSEGFLINEDLKTCSRVDYCLL
SDHGCEYSCVNMDRSFACQCPEGHVLRSDGKTCAKLDSCALGDHGCEHSCVSSEDSFVCQCFEGYILRED
GKTCRRKDVCQAIDHGCEHICVNSDDSYTCECLEGFRLTEDGKRCRRKDVCKSTHHGCEHICVNNGNSYI
CKCSEGFVLAEDGRRCKKCTEGPIDLVFVIDGSKSLGEENFEVVKQFVTGIIDSLTISPKAARVGLLQYS
TQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGEGARPLSTRVPRAAIVFTDGR
AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED
SDGRQDSPAGELPKMVQQPTESEPVTINIQDLLSCSNFAVQHRYLFEEDNLLRSTQKLSHSTKPSGSPLE
EKHDQCKCENLIMFQNLANEEVRKLTQRLEEMTQRMEALENRLRYR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 104.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002371
Locus ID 4147
UniProt ID O00339
Cytogenetics 8q22.1-q22.2
RefSeq Size 4122
RefSeq ORF 2868
Summary This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:Matrilin 2 (MATN2) (NM_002380) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316227 MATN2 MS Standard C13 and N15-labeled recombinant protein (NP_002371) 10 ug
$3,255.00
LC410787 MATN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419365 MATN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429100 MATN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410787 Transient overexpression lysate of matrilin 2 (MATN2), transcript variant 2 100 ug
$436.00
LY419365 Transient overexpression lysate of matrilin 2 (MATN2), transcript variant 1 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.