SLC25A33 (NM_032315) Human Recombinant Protein

SKU
TP316002
Recombinant protein of human solute carrier family 25, member 33 (SLC25A33), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216002 protein sequence
Red=Cloning site Green=Tags(s)

MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSV
TPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAF
ITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESL
KKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFR
EEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115691
Locus ID 84275
UniProt ID Q9BSK2
Cytogenetics 1p36.22
RefSeq Size 1476
RefSeq ORF 963
Synonyms BMSC-MCP; PNC1
Summary SLC25A33 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).[supplied by OMIM, Mar 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SLC25A33 (NM_032315) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316002 SLC25A33 MS Standard C13 and N15-labeled recombinant protein (NP_115691) 10 ug
$3,255.00
LC410215 SLC25A33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410215 Transient overexpression lysate of solute carrier family 25, member 33 (SLC25A33) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.