CCDC91 (NM_018318) Human Recombinant Protein

SKU
TP315991
Recombinant protein of human coiled-coil domain containing 91 (CCDC91), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215991 representing NM_018318
Red=Cloning site Green=Tags(s)

MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPAVSGVHLSPSSPEIVLDRDHSSSIGCLSSDAIISS
PENTHAANSIVSQTIPKAQIQQSTHTHLDISLFPLGLTDEKSNGTIALVDDSEDPGANVSNIQLQQKISS
LEIKLKVSEEEKQRIKQDVESLMEKHNVLEKGFLKEKEQEAISFQDRYKELQEKHKQELEDMRKAGHEAL
SIIVDEYKALLQSSVKQQVEAIEKQYISAIEKQAHKCEELLNAQHQRLLEMLDTEKELLKEKIKEALIQQ
SQEQKEILEKCLEEERQRNKEALVSAAKLEKEAVKDAVLKVVEEERKNLEKAHAEERELWKTEHAKDQEK
VSQEIQKAIQEQRKISQETVKAAIIEEQKRSEKAVEEAVKRTRDELIEYIKEQKRLDQVIRQRSLSSLEL
FLSCAQKQLSALIATEPVDIE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060788
Locus ID 55297
UniProt ID Q7Z6B0
Cytogenetics 12p11.22
RefSeq Size 2352
RefSeq ORF 1323
Synonyms HSD8; p56
Summary Involved in the regulation of membrane traffic through the trans-Golgi network (TGN). Functions in close cooperation with the GGAs in the sorting of hydrolases to lysosomes.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CCDC91 (NM_018318) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315991 CCDC91 MS Standard C13 and N15-labeled recombinant protein (NP_060788) 10 ug
$3,255.00
LC413161 CCDC91 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413161 Transient overexpression lysate of coiled-coil domain containing 91 (CCDC91) 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.