MAGIX (NM_001099682) Human Recombinant Protein

SKU
TP315846
Recombinant protein of human MAGI family member, X-linked (MAGIX), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215846 representing NM_001099682
Red=Cloning site Green=Tags(s)

MEPRTGGAANPKGSRGSRGPSPLAGPSARQLLARLDARPLAARAAVDVAALVRRAGATLRLRRKEAVSVL
DSADIEVTDSRLPHATIVDHRPQVGDLVLHINGESTQGLTHAQAVERIRAGGPQLHLVIRRPLETHPGKP
RGVGEPRKGVDRSPDPGGPEVTGSRSSSTSLVQHPPSRTTLKKTRGSPEPSPEAAADGPTVSPPERRAED
PNDQIPGSPGPWLVPSEERLSRALGVRGAAQLAQEMAAGRRRH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001093152
Locus ID 79917
UniProt ID Q9H6Y5
Cytogenetics Xp11.23
RefSeq Size 1907
RefSeq ORF 759
Synonyms JM10; PDZX
Write Your Own Review
You're reviewing:MAGIX (NM_001099682) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315846 MAGIX MS Standard C13 and N15-labeled recombinant protein (NP_001093152) 10 ug
$3,255.00
PH315910 MAGIX MS Standard C13 and N15-labeled recombinant protein (NP_079135) 10 ug
$3,255.00
LC411025 MAGIX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420494 MAGIX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411025 Transient overexpression lysate of MAGI family member, X-linked (MAGIX), transcript variant 1 100 ug
$436.00
LY420494 Transient overexpression lysate of MAGI family member, X-linked (MAGIX), transcript variant 4 100 ug
$436.00
TP315910 Recombinant protein of human MAGI family member, X-linked (MAGIX), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.