FABP9 (NM_001080526) Human Recombinant Protein

SKU
TP315816
Recombinant protein of human fatty acid binding protein 9, testis (FABP9), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215816 representing NM_001080526
Red=Cloning site Green=Tags(s)

MVEPFLGTWKLVSSENFEDYMKELGVNFAARNMAGLVKPTVTISVDGKMMTIRTESSFQDTKISFKLGEE
FDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEKMVVECKMNNIVSTRIYEKV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001073995
Locus ID 646480
UniProt ID Q0Z7S8
Cytogenetics 8q21.13
RefSeq Size 399
RefSeq ORF 396
Synonyms PERF; PERF15; T-FABP; TLBP
Write Your Own Review
You're reviewing:FABP9 (NM_001080526) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315816 FABP9 MS Standard C13 and N15-labeled recombinant protein (NP_001073995) 10 ug
$3,255.00
LC421081 FABP9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421081 Transient overexpression lysate of fatty acid binding protein 9, testis (FABP9) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.